PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G386900.1.p
Common NameLOC101784221, SETIT_004755mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 463aa    MW: 49489 Da    PI: 4.6292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G386900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-18115161148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEd +l+d v qlG ++W+ Ia+ ++ gR +kqc++rw ++l
  Seita.5G386900.1.p 115 KGTWTEEEDSILKDMVMQLGERSWSVIAQSLP-GRIGKQCRERWINHL 161
                         799*****************************.************996 PP

2Myb_DNA-binding49.97.1e-16171210445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         WT+e+d++l+ a+k +G++ W++Iar ++ gR+++ +k++w+
  Seita.5G386900.1.p 171 WTEEDDKILIGAHKNFGNR-WSSIARFLP-GRSENAIKNHWN 210
                         *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.263110165IPR017930Myb domain
SMARTSM007172.7E-16114163IPR001005SANT/Myb domain
SuperFamilySSF466893.13E-29114209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-22115163IPR009057Homeodomain-like
PfamPF002498.1E-17115161IPR001005SANT/Myb domain
CDDcd001676.51E-15117161No hitNo description
Gene3DG3DSA:1.10.10.601.7E-18164214IPR009057Homeodomain-like
PROSITE profilePS5129415.894167217IPR017930Myb domain
SMARTSM007179.8E-13167215IPR001005SANT/Myb domain
CDDcd001671.91E-12171213No hitNo description
PfamPF002491.0E-13171210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MAFEESAVFN RVLAAALVGD EVAVSYLASS GHGGPRFEHN LVAPSFIQVG GAQSMGGPLD  60
VSSLVASIGM TPVGFQMPEG AITTSSYNAL GGIPIDAAVA PQPEIENDGK PAPFKGTWTE  120
EEDSILKDMV MQLGERSWSV IAQSLPGRIG KQCRERWINH LHPDIKQNDI WTEEDDKILI  180
GAHKNFGNRW SSIARFLPGR SENAIKNHWN ATKRSLKSNR RLKKKKSEQV PPGQFSILEE  240
YIRTVSPPSE SVAPPPPMSP PPQGLAYNGP VVGPEAVHSP APQMEMNFNA ANPSGPPSPH  300
LQGMINHNMP LLPDLNISCD PQEAYHMSYP MRAPAPVPPL QMVTQDPHQA SFSWLPFAEY  360
LTEPNPGLAA GPSYYTGGYY SNAGANGYYS EAGPSNAGAN SYYSEAGPSN ACADGYYSEA  420
GPSNAGGSGG EPAGDTDNIA ELVSSEEFFS NDDVNLDFTR FG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-411152144102C-Myb DNA-Binding Domain
1msf_C5e-411152144102C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218225NRRLKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.10.0PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS580.0K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-39myb domain protein 98